SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358696 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358696
Domain Number 1 Region: 26-488
Classification Level Classification E-value
Superfamily Sema domain 3.4e-123
Family Sema domain 0.0000506
Further Details:      
 
Domain Number 2 Region: 1328-1457,1652-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-50
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 1019-1124
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000229
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 4 Region: 837-932
Classification Level Classification E-value
Superfamily E set domains 0.00000000000153
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 932-1021
Classification Level Classification E-value
Superfamily E set domains 0.00000000000153
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 6 Region: 491-541
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1122-1201
Classification Level Classification E-value
Superfamily E set domains 0.00000202
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 
Weak hits

Sequence:  ENSP00000358696
Domain Number - Region: 789-823
Classification Level Classification E-value
Superfamily Plexin repeat 0.000288
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 635-671
Classification Level Classification E-value
Superfamily Plexin repeat 0.0419
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358696   Gene: ENSG00000130827   Transcript: ENST00000369682
Sequence length 1871
Comment pep:known chromosome:GRCh37:X:153686621:153701989:1 gene:ENSG00000130827 transcript:ENST00000369682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVCLLLLLFLAVGGALGNRPFRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNL
TELRAHVTGPVEDNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGIC
QFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQGQGPSKLFVGTAVDGKSEYFPT
LSSRKLISDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFLT
LQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAKP
GLLLAQALGVPADEDVLFTIFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRGE
GTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAAY
TYRQHSVVFIGTRSGSLKKVRVDGFQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLSE
KQVSQLPVETCEQYQSCAACLGSGDPHCGWCVLRHRCCREGACLGASAPHGFAEELSKCV
QVRVRPNNVSVTSPGVQLTVTLHNVPDLSAGVSCAFEAAAENEAVLLPSGELLCPSPSLQ
ELRALTRGHGATRTVRLQLLSKETGVRFAGADFVFYNCSVLQSCMSCVGSPYPCHWCKYR
HTCTSRPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNYE
CVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEHGDTELDFSVVWDGDFPIDKPPSFR
ALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRTHCPAPKTNWMHLSQKGTRCSHP
RITQIHPLVGPKEGGTRVTIVGDNLGLLSREVGLRVAGVRCNSIPAEYISAERIVCEMEE
SLVPSPPPGPVELCVGDCSADFRTQSEQVYSFVTPTFDQVSPSRGPASGGTRLTISGSSL
DAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYT
QDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLCK
APGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVKP
GSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCSLTVSDTQLLCDSPSQTGRQPVMVLVGG
LEFWLGTLHISAERALTLPAMMGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQM
DNLESRVALECKEAFAELQTDINELTNHMDEVQIPFLDYRTYAVRVLFPGIEAHPVLKEL
DTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYAT
GLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLLY
CAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENEGSAQVPVKVLNC
DSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLN
SLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMITP
DQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTA
HRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
NSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMAS
ISDQDMDAYLVEQSRLHASDFSVLSALNELYFYVTKYRQEILTALDRDASCRKHKLRQKL
EQIISLVSSDS
Download sequence
Identical sequences P51805
ENSP00000358696 NYSGRC-59710104 ENSP00000358696 9606.ENSP00000358696 gi|59710104|ref|NP_059984.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]