SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358872 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358872
Domain Number 1 Region: 169-271
Classification Level Classification E-value
Superfamily E set domains 1.83e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 2 Region: 368-461
Classification Level Classification E-value
Superfamily E set domains 6.67e-28
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 3 Region: 560-652
Classification Level Classification E-value
Superfamily E set domains 1.2e-26
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 4 Region: 688-779
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 5 Region: 463-557
Classification Level Classification E-value
Superfamily E set domains 5.6e-25
Family Filamin repeat (rod domain) 0.0000114
Further Details:      
 
Domain Number 6 Region: 54-84,112-174
Classification Level Classification E-value
Superfamily E set domains 2.68e-23
Family Filamin repeat (rod domain) 0.00025
Further Details:      
 
Domain Number 7 Region: 289-382
Classification Level Classification E-value
Superfamily E set domains 1.13e-21
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 8 Region: 2-68
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000327
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358872   Gene: ENSG00000196924   Transcript: ENST00000369856
Sequence length 780
Comment pep:known chromosome:GRCh37:X:153577024:153586605:-1 gene:ENSG00000196924 transcript:ENST00000369856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVT
AYGPGLTHGVVNKPATFTVNTKDAGEGDDSMRMSHLKVGSAADIPINISETDLSLLTATV
VPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDA
SRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYC
PTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIP
EISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQ
FTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFED
RKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKV
NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFN
GTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTID
GPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSL
HETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGN
NMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP
Download sequence
Identical sequences ENSP00000358872 ENSP00000472949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]