SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359565 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359565
Domain Number 1 Region: 51-196
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000116
Family CBS-domain pair 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSP00000359565
Domain Number - Region: 289-342
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00103
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359565   Gene: ENSG00000119946   Transcript: ENST00000370534
Sequence length 607
Comment pep:known chromosome:GRCh37:10:101089688:101151296:1 gene:ENSG00000119946 transcript:ENST00000370534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQGALELR
TKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLA
FVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGEGDPFY
EVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPQRERKRHDFSLFKLSDTEMRVKI
SPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDEKNKKAPEHYLYQRN
RPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTTACSDNDVRKVGSLAGSSVF
LPVSVSRTFAVSRGDSLAGSPVNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLY
MPDYSVHILSDVQFVKITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQT
PKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSP
AAVPTRAASDSECCNINLDTETSPCSSDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNS
NLTPLIT
Download sequence
Identical sequences ENSP00000359565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]