SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360475 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360475
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily E set domains 4.97e-21
Family Arrestin/Vps26-like 0.022
Further Details:      
 
Domain Number 2 Region: 147-295
Classification Level Classification E-value
Superfamily E set domains 2.1e-16
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360475   Gene: ENSG00000197070   Transcript: ENST00000371421
Sequence length 433
Comment pep:known chromosome:GRCh37:9:140500106:140509810:1 gene:ENSG00000197070 transcript:ENST00000371421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
SCGGVEPSLTPES
Download sequence
Identical sequences Q8N5I2
NP_689498.1.87134 NP_689498.1.92137 ENSP00000360475 ENSP00000360475 ENSP00000360475 GO.37007 gi|22748653|ref|NP_689498.1| 9606.ENSP00000360475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]