SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362480 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000362480
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.0406
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362480   Gene: ENSG00000122958   Transcript: ENST00000373382
Sequence length 327
Comment pep:known chromosome:GRCh37:10:70883268:70932617:1 gene:ENSG00000122958 transcript:ENST00000373382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
KLRKQRTNFHQRFESPESQASAEQPEM
Download sequence
Identical sequences A0A096P4Z9 A0A0D9R621 A0A2K5CJE8 A0A2K5MV51 A0A2K5PTE5 A0A2K6D6U3 A0A2K6K226 A0A2K6NBY6 A0A2K6U5Z7 F7H2J7 G1RLF3 H2NAQ1 H2Q203 H9EPD6 I7GLB1 O75436
ENSP00000263559 ENSP00000362480 ENSPANP00000020424 ENSP00000263559 ENSNLEP00000014061 ENSCJAP00000023678 9598.ENSPTRP00000004436 9600.ENSPPYP00000002770 9606.ENSP00000263559 ENSP00000263559 ENSP00000362480 ENSNLEP00000014061 ENSPTRP00000004436 gi|17978519|ref|NP_004887.2| ENSPPYP00000002770 ENSPTRP00000004436 ENSPPYP00000002770 ENSCJAP00000023678 NP_001244870.1.72884 NP_004887.2.87134 NP_004887.2.92137 XP_002756337.1.60252 XP_003815966.1.60992 XP_003928709.1.74449 XP_009243808.1.23681 XP_010361118.1.97406 XP_011940653.1.92194 XP_012306855.1.9421 XP_016773949.1.37143 XP_017404417.1.71028 XP_017730496.1.44346 GO.35425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]