SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362502 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362502
Domain Number 1 Region: 146-280
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.07e-45
Family Transglutaminase core 0.000000114
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 3.29e-44
Family Transglutaminase N-terminal domain 0.000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362502   Gene: ENSG00000198959   Transcript: ENST00000373403
Sequence length 280
Comment pep:known chromosome:GRCh37:20:36775136:36794910:-1 gene:ENSG00000198959 transcript:ENST00000373403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVF
Download sequence
Identical sequences A2A299
ENSP00000362502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]