SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000363619 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363619
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily E set domains 7e-75
Family Arrestin/Vps26-like 0.000000431
Further Details:      
 
Domain Number 2 Region: 176-355
Classification Level Classification E-value
Superfamily E set domains 3.5e-55
Family Arrestin/Vps26-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363619   Gene: ENSG00000120500   Transcript: ENST00000374495
Sequence length 359
Comment pep:known chromosome:GRCh37:X:69488155:69501082:1 gene:ENSG00000120500 transcript:ENST00000374495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR
Download sequence
Identical sequences ENSP00000363619 ENSP00000363619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]