SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364627 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364627
Domain Number 1 Region: 95-179
Classification Level Classification E-value
Superfamily E set domains 0.000000000911
Family Filamin repeat (rod domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364627   Gene: ENSG00000137634   Transcript: ENST00000375478
Sequence length 544
Comment pep:known chromosome:GRCh37:11:114441654:114466484:-1 gene:ENSG00000137634 transcript:ENST00000375478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISMINYKSLLALLFILASWIIFTVFQNSTKVWSALNLSISLHYWNNSTKSLFPKTPLI
SLKPLTETELRIKEIIEKLDQQIPPRPFTHVNTTTSATHSTATILNPRDTYCRGDQLHIL
LEVRDHLGRRKQYGGDFLRARMSSPALMAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLL
LIHPSEGVSALWSARNQGYDRVIFTGQFVNGTSQVHSECGLILNTNAELCQYLDNRDQEG
FYCVRPQHMPCAALTHMYSKNKKVSYLSKQEKSLFERSNVGVEIMEKFNTISVSKCNKET
VAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEY
FKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKYCYPLIGSMTYSVKEMEYLTRAI
DRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHKAIQHLLLRSPDTMVIIKTENIREM
YNDAERFSDFHGYIQYLIIKDIFQDLSVSIIDAWDITIAYGTNNVHPPQHVVGNQINILL
NYIC
Download sequence
Identical sequences Q6UWF7
NP_001071107.1.87134 NP_001071107.1.92137 XP_011541183.1.92137 ENSP00000364627 9606.ENSP00000364627 gi|117647230|ref|NP_001071107.1| ENSP00000364627 NYSGRC-IgSF-FA55D_HUMAN ENSP00000364627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]