SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364831 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364831
Domain Number 1 Region: 38-367,399-534
Classification Level Classification E-value
Superfamily Clc chloride channel 3.79e-88
Family Clc chloride channel 0.00093
Further Details:      
 
Domain Number 2 Region: 542-677
Classification Level Classification E-value
Superfamily CBS-domain pair 2.24e-23
Family CBS-domain pair 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364831   Gene: ENSG00000184908   Transcript: ENST00000375679
Sequence length 687
Comment pep:known chromosome:GRCh37:1:16370272:16383803:1 gene:ENSG00000184908 transcript:ENST00000375679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLM
ALVSCAMDLAVESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGG
SGIPEVKTMLAGVVLEDYLDIKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYL
GRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGLCGILGSAYL
FCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLASRLSMKQHLDS
LFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTH
TISTALLAFEVTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNI
GSHRVRVEHFMNHSITTLAKDMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLV
QALKAEPPSWAPGHQQCLQDILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTS
RGRAVGCVSWVEMKKAISNLTNPPAPK
Download sequence
Identical sequences P51801
ENSP00000364819 ENSP00000364831 NP_000076.2.87134 NP_000076.2.92137 9606.ENSP00000364831 gi|155969705|ref|NP_000076.2| ENSP00000364831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]