SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365092 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000365092
Domain Number - Region: 58-122
Classification Level Classification E-value
Superfamily Tropomyosin 0.049
Family Tropomyosin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365092   Gene: ENSG00000134884   Transcript: ENST00000375926
Sequence length 142
Comment pep:known chromosome:GRCh37:13:107196176:107214299:-1 gene:ENSG00000134884 transcript:ENST00000375926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNEKFSEGWRKPNASWKSSCSKNSSDRDKLSLPHKKLERGSWRVWQPRSTLCRTLDKT
EEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEE
QKIILGKGKSRPKLSFSLKTQD
Download sequence
Identical sequences X6R9F1
ENSP00000365092 ENSP00000365092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]