SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000365172 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365172
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily E set domains 0.000000000000133
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365172   Gene: ENSG00000134901   Transcript: ENST00000376004
Sequence length 502
Comment pep:known chromosome:GRCh37:13:103436631:103451357:-1 gene:ENSG00000134901 transcript:ENST00000376004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGTLLLYCFFLATVPALAETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGN
KFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQH
VAKSPYILKGPVYHENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIP
KRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDVELFVNLGDWP
LEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWES
KNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDENLYGPIVKHISFFDFF
KHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKKTKDEL
Download sequence
Identical sequences Q6UW63
gi|176866369|ref|NP_076994.2| ENSP00000365172 ENSP00000365172 9606.ENSP00000365172 HR3231 NYSGRC-IgSF-KDEL1_HUMAN ENSP00000365172 NP_076994.2.87134 NP_076994.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]