SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000367655 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367655
Domain Number 1 Region: 372-479
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.83e-19
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1830-1910
Classification Level Classification E-value
Superfamily E set domains 3.92e-17
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Domain Number 3 Region: 2091-2178
Classification Level Classification E-value
Superfamily E set domains 4.73e-16
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 4 Region: 1914-1996
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000108
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 1157-1234
Classification Level Classification E-value
Superfamily E set domains 0.000000000000013
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 
Domain Number 6 Region: 1239-1319
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000331
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Domain Number 7 Region: 2000-2085
Classification Level Classification E-value
Superfamily E set domains 0.00000000000035
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.029
Further Details:      
 
Domain Number 8 Region: 1066-1144
Classification Level Classification E-value
Superfamily E set domains 0.00000000000548
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 9 Region: 3255-3376,3405-3546
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000118
Family Galacturonase 0.077
Further Details:      
 
Domain Number 10 Region: 1661-1743
Classification Level Classification E-value
Superfamily E set domains 0.0000000000165
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 11 Region: 271-334
Classification Level Classification E-value
Superfamily E set domains 0.0000000000572
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 12 Region: 1563-1641
Classification Level Classification E-value
Superfamily E set domains 0.000000000224
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 13 Region: 1748-1825
Classification Level Classification E-value
Superfamily E set domains 0.000000000251
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 14 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.000000000296
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 15 Region: 1331-1388
Classification Level Classification E-value
Superfamily E set domains 0.000000000815
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Domain Number 16 Region: 32-125
Classification Level Classification E-value
Superfamily E set domains 0.0000000127
Family Other IPT/TIG domains 0.065
Further Details:      
 
Domain Number 17 Region: 1406-1502
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000129
Family Plastocyanin/azurin-like 0.047
Further Details:      
 
Weak hits

Sequence:  ENSP00000367655
Domain Number - Region: 2474-2688
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00023
Family Pectate lyase-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367655   Gene: ENSG00000205038   Transcript: ENST00000378402
Sequence length 4243
Comment pep:known chromosome:GRCh37:8:110374706:110542559:1 gene:ENSG00000205038 transcript:ENST00000378402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSINGATRLTIRGEGFSQAN
QFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYTRAMPEDSYTVRVSVDGVP
VTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIALS
SNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMVCKTTGTFIGHHNVSFI
LDNDYGRSFPQKMAYFVSSLNKIAMFQTYAEVTMIFPSQGSIRGGTTLTISGRFFDQTDF
PVRVLVGGEPCDILNVTENSICCKTPPKPHILKTVYPGGRGLKLEVWNNSRPIRLEEILE
YNEKTPGYMGASWVDSASYIWLMEQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQ
TGLPEDKVRIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQ
YRNVYTEQQTGDAVNEEQVIKSQSTILQEVQVITLENWETTNAINEVQKIKVTSPCVEAN
SCSLYQYRLIYNMEKTVFLPADASEFILQSALNDLWSIKPDTVQVIRTQNPQSYVYMVTF
ISTRGDFDLLGYEVVEGNNVTLDITEQTKGKPNLETFTLNWDGIASKPLTLWSSEAEFQG
AVEEMVSTKCPPQIANFEEGFVVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPA
VLFDSADVKPNRRPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDNSKITRSTDTQFTY
NFAYGNNWTYTCIDLLDLVRTKYTGTNVSLQRISLHKASESQSFYVDVVYIGHTSTISTL
DEMPKRRLPALANKGIFLEHFQVNQTKTNGPTMTNQYSVTMTSYNCSYNIPMMAVSFGQI
ITHETENEFVYRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGHILKGLPAAVSAADLQ
FALQSLEGMGRISVTREGTCAGYAWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKE
GGLFRQHVLGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSNITPLVLAISPSQGSYE
EGTILTIVGSGFSPSSAVTVSVGPVGCSLLSVDEKELKCQILNGSAGHAPVAVSMADVGL
AQNVGGEEFYFVYQSQISHIWPDSGSIAGGTLLTLSGFGFNENSKVLVGNETCNVIEGDL
NRITCRTPKKTEGTVDISVTTNGFQATARDAFSYNCLQTPIITDFSPKVRTILGEVNLTI
KGYNFGNELTQNMAVYVGGKTCQILHWNFTDIRCLLPKLSPGKHDIYVEVRNWGFASTRD
KLNSSIQYVLEVTSMFPQRGSLFGGTEITIRGFGFSTIPAENTVLLGSIPCNVTSSSENV
IKCILHSTGNIFRITNNGKDSVHGLGYAWSPPVLNVSVGDTVAWHWQTHPFLRGIGYRIF
SVSSPGSVIYDGKGFTSGRQKSTSGSFSYQFTSPGIHYYSSGYVDEAHSIFLQGVINVLP
AETRHIPLHLFVGRSEATYAYGGPENLHLGSSVAGCLATEPLCSLNNTRVKNSKRLLFEV
SSCFSPSISNITPSTGTVNELITIIGHGFSNLPWANKVTIGSYPCVVEESSEDSITCHID
PQNSMDVGIRETVTLTVYNLGTAINTLSNEFDRRFVLLPNIDLVLPNAGSTTGMTSVTIK
GSGFAVSSAGVKVLMGHFPCKVLSVNYTAIECETSPAAQQLVDVDLLIHGVPAQCQGNCT
FSYLESITPYITGVFPNSVIGSVKVLIEGEGLGTVLEDIAVFIGNQQFRAIEVNENNITA
LVTPLPVGHHSVSVVVGSKGLALGNLTVSSPPVASLSPTSGSIGGGTTLVITGNGFYPGN
TTVTIGDEPCQIISINPNEVYCRTPAGTTGMVDVKIFVNTIAYPPLLFTYALEDTPFLRG
IIPSRGPPGTEIEITGSNFGFEILEISVMINNIQCNVTMANDSVVQCIVGDHAGGTFPVM
MHHKTKGSAMSTVVFEYPLNIQNINPSQGSFGGGQTMTVTGTGFNPQNSIILVCGSECAI
DRLRSDYTTLLCEIPSNNGTGAEQACEVSVVNGKDLSQSMTPFTYAVSLTPLITAVSPKR
GSTAGGTRLTVVGSGFSENMEDVHITIAEAKCDVEYSNKTHIICMTDAHTLSGWAPVCVH
IRGVGMAKLDNADFLYVDAWSSNFSWGGKSPPEEGSLVVITKGQTILLDQSTPILKMLLI
QGGTLIFDEADIELQAENILITDGGVLQIGTETSPFQHKAVITLHGHLRSPELPVYGAKT
LAVREGILDLHGVPVPVTWTRLAHTAKAGERILILQEAVTWKPGDNIVIASTGHRHSQGE
NEKMTIASVSADGINITLSNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNV
EWNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCVMFHAPVPGANMVTGRIEYV
EVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYD
IKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAVAGGT
HFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTS
TVPAPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETN
GAVIKNAKIVGHLDELGMGSAFCTAKGLVLPFSEGLTVSSVHFMNFDRPNCVALGVTSIS
GVCNDRCGGWSAKFVDVQYSHTPNKAGFRWEHEMVMIDVDGSLTGHKGHTVIPHSSLLDP
SHCTQEAEWSIGFPGSVCDASVSFHRLAFNQPSPVSLLEKDVVLSDSFGTSIIPFQKKRL
THMSGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKEEDYVIISHNFTQNPDMFNII
DMRNGSSNPLNWNTSKNGDWHLEANTSTLYYLVSGRNDLHQSQLISGNLDPDVKDVVINF
QAYCCILQDCFPVHPPSRKPIPKKRPATYNLWSNDSFWQSSRENNYTVPHPGANVIIPEG
TWIVADIDMPSMERLIIWGVLELEDKYNVGAAESSYREVVLNATYISLQGGRLIGGWEDN
PFKGDLKIVLRGNHTTQDWALPEGPNQGAKVLGVFGELDLHGIPHSIYKTKLSETAFAGS
KVLSLMDAVDWQEGEEIVITTTSYDFHQTETRSIVKILHDHKILILNDSLSYTHFAEKYH
VPGTGESYTLAADVGILSRNIKIVGEDYPGWSEDSFGARVLVGSFTENMMTFKGNARISN
VEFYHSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIRGCAFHHGFSPAIGVFGTDGLDI
DDNIIHFTVGEGIRIWGNANRVRGNLIALSVWPGTYQNRKDLSSTLWHAAIEINRGTNTV
LQNNVVAGFGRAGYRIDGEPCPGQFNPVEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFT
IWTCWDYGIYFQTTESVHIYNVTLVDNGMAIFPMIYMPAAISHKISSKNVQIKSSLIVGS
SPGFNCSDVLTNDDPNIELTAAHRSPRSPSGGRSGICWPTFASAHNMAPRKPHAGIMSYN
AISGLLDISGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIKLVDTTEQSKIFIH
RPDISKVNPSDCVDMVCDAKRKSFLRDIDGSFLGNAGSVIPQAEYEWDGNSQVGIGDYRI
PKAMLTFLNGSRIPVTEKAPHKGIIRDSTCKYLPEWQSYQCFGMEYAMMVIESLDPDTET
RRLSPVAIMGNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEVYFTGTSPQNL
RLMLLNVDHNKAVLVGIFFSTLQRLDVYVNNLLVCPKTTIWNAQQKHCELNNHLYKDQFL
PNLDSTVLGENYFDGTYQMLYLLVKGTIPVEIHTATVIFVSFQLSVATEDDFYTSHNLVK
NLALFLKIPSDKIRISKIRGKSLRRKRSMGFIIEIEIGDPPIQFISNGTTGQMQLSELQE
IAGSLGQAVILGNISSILGFNISSMSITNPLPSPSDSGWIKVTAQPVERSAFPVHHVAFV
SSLLVITQPVAAQPGQPFPQQPSVKATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSG
NTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVGVESRTFSLLAESVSSSGSSSSSNS
KASTVGTYAQIMTVVISCLVGRMWLLEIFMAAVSTLNITLRSY
Download sequence
Identical sequences Q86WI1
ENSP00000367655 gi|126116589|ref|NP_803875.2| 9606.ENSP00000367655 NP_803875.2.87134 NP_803875.2.92137 ENSP00000367655 ENSP00000367655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]