SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369046 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369046
Domain Number 1 Region: 64-109
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000277
Family Ovomucoid domain III-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369046   Gene: ENSG00000122711   Transcript: ENST00000379723
Sequence length 109
Comment pep:known chromosome:GRCh37:9:33220977:33248564:1 gene:ENSG00000122711 transcript:ENST00000379723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGIGSSPHLLWTLEGTHIWSLLGDASHTDRLPEAGAGKLLSEVPVAAGKLPFSRMPIC
EHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGKC
Download sequence
Identical sequences Q5VZE7
ENSP00000369048 ENSP00000369046 ENSP00000369048 ENSP00000369045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]