SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000369268 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369268
Domain Number 1 Region: 278-466
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-44
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 28-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-31
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369268   Gene: ENSG00000132259   Transcript: ENST00000379936
Sequence length 575
Comment pep:known chromosome:GRCh37:11:6260322:6265659:1 gene:ENSG00000132259 transcript:ENST00000379936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
Download sequence
Identical sequences Q8IV77
ENSP00000369268 NP_001032406.1.87134 NP_001032406.1.92137 ENSP00000369268 ENSP00000369268 9606.ENSP00000369268 gi|82617546|ref|NP_001032406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]