SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000370209 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370209
Domain Number 1 Region: 56-103,143-376,411-556
Classification Level Classification E-value
Superfamily Clc chloride channel 7.06e-117
Family Clc chloride channel 0.00017
Further Details:      
 
Domain Number 2 Region: 555-716
Classification Level Classification E-value
Superfamily CBS-domain pair 1.19e-30
Family CBS-domain pair 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370209   Gene: ENSG00000073464   Transcript: ENST00000380829
Sequence length 729
Comment pep:novel chromosome:GRCh37:X:10126488:10201737:1 gene:ENSG00000073464 transcript:ENST00000380829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEF
IKSLLDAWSGWVVMLLIGLLAGTLAGVIDLAVDWMTDLKEGVCLSAFWYSHEQCCWTSNE
TTFEDRDKCPLWQKWSELLVNQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACG
SGIPEIKTILSGFIIRGYLGKWTLLIKTVTLVLVVSSGLSLGKEGPLVHVACCCGNFFSS
LFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALV
AAFTLRSINPFGNSRLVLFYVEYHTPWRRKTTRLGKYPVLEVIVVTAITAIIAYPNPYTR
QSTSELISELFNDCGALESSQLCDYINDPNMTRPVDDIPDRPAGVGVYTAMWQLALALIF
KIVVTIFTFGMKIPSGLFIPSMAVGAIAGRMVGIGVEQLAYHHHDWIIFRNWCRPGADCV
TPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAVTSKWVADAFGKEGI
YEAHIHLNGYPFLDVKDEFTHRTLATDVMRPRRGEPPLSVLTQDSMTVEDVETLIKETDY
NGFPVVVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPL
KLRRILNLSPFTVTDHTPMETVVDIFRKLGLRQCLVTRSGRLLGIITKKDVLRHMAQMAN
QDPESIMFN
Download sequence
Identical sequences A0A2I2Z087 A0A2I3LLY3 A0A2J8W4R9 A0A2K5CUW4 A0A2K5HU15 A0A2K5P7N2 A0A2K5XN57 A0A2K6U3F0 G3XAG5 H2QYA0
ENSP00000370209 ENSP00000370209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]