SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000370850 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370850
Domain Number 1 Region: 104-168,195-252
Classification Level Classification E-value
Superfamily EF-hand 0.0000104
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370850   Gene: ENSG00000109184   Transcript: ENST00000381441
Sequence length 257
Comment pep:known chromosome:GRCh37:4:52709229:52783003:1 gene:ENSG00000109184 transcript:ENST00000381441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKV
MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVV
GPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTL
DYLRSFLNDSTNFKLIYRYAFDFARQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAW
PVLLDEFVEWYKDKQMS
Download sequence
Identical sequences A0A2I2ZYU7 A0A2K5JK53 A0A2K5MA55 A0A2K5ZSI3 A0A2K6BTH8 H9ENL0
NP_055930.2.87134 NP_055930.2.92137 XP_004038711.1.27298 XP_011770519.1.29376 XP_011815441.1.43180 XP_011839704.1.47321 XP_011928982.1.92194 ENSP00000370850 gi|94536780|ref|NP_055930.2| ENSP00000370850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]