SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000370867 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370867
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.31e-122
Family Transglutaminase core 0.00000000000754
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 1.54e-42
Family Transglutaminase N-terminal domain 0.000000216
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.83e-31
Family Transglutaminase, two C-terminal domains 0.000000654
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-26
Family Transglutaminase, two C-terminal domains 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370867   Gene: ENSG00000125780   Transcript: ENST00000381458
Sequence length 693
Comment pep:known chromosome:GRCh37:20:2276647:2321724:1 gene:ENSG00000125780 transcript:ENST00000381458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD
ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences Q08188
gi|189458821|ref|NP_003236.3| 9606.ENSP00000370867 ENSP00000370867 ENSP00000370867 ENSP00000370867 NP_003236.3.87134 NP_003236.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]