SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000371234 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000371234
Domain Number - Region: 37-112
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0126
Family BphP N-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371234   Gene: ENSG00000205795   Transcript: ENST00000381813
Sequence length 158
Comment pep:known chromosome:GRCh37:2:10196907:10220538:-1 gene:ENSG00000205795 transcript:ENST00000381813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSP
VAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSG
NVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR
Download sequence
Identical sequences Q717R9
gi|81158080|ref|NP_001032237.1| 9606.ENSP00000371234 NP_001032237.1.87134 NP_001032237.1.92137 ENSP00000371234 ENSP00000371234 ENSP00000371234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]