SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000371427 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371427
Domain Number 1 Region: 750-1059
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.66e-91
Family Complement components 0.0000317
Further Details:      
 
Domain Number 2 Region: 1132-1263
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.71e-40
Family Alpha-macroglobulin receptor domain 0.000000789
Further Details:      
 
Domain Number 3 Region: 661-700
Classification Level Classification E-value
Superfamily E set domains 0.000000000168
Family SVA-like 0.049
Further Details:      
 
Weak hits

Sequence:  ENSP00000371427
Domain Number - Region: 269-342
Classification Level Classification E-value
Superfamily ADC synthase 0.00746
Family ADC synthase 0.017
Further Details:      
 
Domain Number - Region: 229-286
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.029
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371427   Gene: ENSG00000126838   Transcript: ENST00000381997
Sequence length 1268
Comment pep:known chromosome:GRCh37:12:9301437:9355001:-1 gene:ENSG00000126838 transcript:ENST00000381997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESYRRTTFPVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSLKLEAGINQLSF
PLSSEPIQGSYRVVVQTESGGRIQHPFTVEEFVLPKFEVKVQVPKIISIMDEKVNITVCG
EYTYGKPVPGLATVSLCRKLSRVLNCDKQEVCEEFSQQLNSNGCITQQVHTKMLQITNTG
FEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVKVDSHFRQGIPFFAQVLLVDGK
GVPIPNKLFFISVNDANYYSNATTNEQGLAQFSINTTSISVNKLFVRVFTVHPNLCFHYS
WVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYTLNRQAMGELSELSF
HYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDS
EKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSV
SSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGL
KVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSG
PVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTAS
LRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVS
EQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLN
YLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFGERYGRNQGNTWLTAFVLKT
FAQARSYIFIDEAHITQSLTWLSQMQKDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIA
LLEIPLPVTNPIVRNALFCLESAWNVAKEGTHGSHVYTKALLAYAFSLLGKQNQNREILN
SLDKEAVKEDNLVHWERPQRPKAPVGHLYQTQAPSAEVEMTSYVLLAYLTAQPAPTSGDL
TSATNIVKWIMKQQNAQGGFSSTQDTVVALHALSRYGAATFTRTEKTAQVTVQDSQTFST
NFQVDNNNLLLLQQISLPELPGEYVITVTGERCVYLQTSMKYNILPEKEDSPFALKVQTV
PQTCDGHKAHTSFQISLTISYTGNRPASNMVIVDVKMVSGFIPLKPTVKMLERSSSVSRT
EVSNNHVLIYVEQVTNQTLSFSFMVLQDIPVGDLKPAIVKVYDYYETDESVVAEYIAPCS
TDTEHGNV
Download sequence
Identical sequences ENSP00000371427 XP_016875255.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]