SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000373272 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373272
Domain Number 1 Region: 604-868
Classification Level Classification E-value
Superfamily NHL repeat 2.43e-50
Family NHL repeat 0.000056
Further Details:      
 
Domain Number 2 Region: 486-580
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 269-331
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Domain Number 4 Region: 55-102
Classification Level Classification E-value
Superfamily RING/U-box 0.00000471
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373272   Gene: ENSG00000206557   Transcript: ENST00000383763
Sequence length 868
Comment pep:known chromosome:GRCh37:3:32859510:32939318:1 gene:ENSG00000206557 transcript:ENST00000383763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP
CLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL
DAVVATADEPPPKNGRAGAPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSA
PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER
GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVV
QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSS
GAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEV
SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA
CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR
NHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQS
ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ
MDRPSGIAITPDGMIVVVDFGNNRILVF
Download sequence
Identical sequences G3RLQ5 H2R8E3 Q2Q1W2
NP_001034200.1.87134 NP_001034200.1.92137 XP_004033855.2.27298 XP_016796123.1.37143 gi|84993742|ref|NP_001034200.1| ENSP00000373272 ENSP00000373272 9606.ENSP00000373272 ENSP00000373272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]