SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000374237 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374237
Domain Number 1 Region: 107-191
Classification Level Classification E-value
Superfamily E set domains 0.0000000205
Family Filamin repeat (rod domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374237   Gene: ENSG00000204361   Transcript: ENST00000389586
Sequence length 559
Comment pep:known chromosome:GRCh37:11:114549108:114577655:1 gene:ENSG00000204361 transcript:ENST00000389586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEKILIHRILTLFPNAIARKLLLMLTFILIFWIIYLASKDHTKFSFNLENHIILNQGNI
FKKYSHSETPLCPAVSPKETELRIKDIMEKLDQQIPPRPFTHVNTTTSATHSTATILNPQ
DTYCRGDQLDILLEVRDHLGHRKQYGGDFLRARMYSTALMAGASGKVTDFNNGTYLVSFT
LFWEGQVSLSLLLIHPSEGVSALWRARNQGCDRIIFTGLFANRSSNVFTECGLTLNTNAE
LCQYMDDRDQEAFYCVRPQHMPCEALTHMTTRTRNISYLSKEEWRLFHRSNIGVEMMKNF
TPIEVIPCNKSENIKKNCQIGMKTPFPSGYTLKKMWITAFCKQIKFNETKNINDCLERKL
IYLMGDSTLHQWIYYLQKAVKTLKYFDHHGAGIFKTHVLLDVERHILIQWKKHGHPFVTK
KLFSVKDENYIPREIDQVAGDKNTAIVITLGQHFRPFPINIFIRRAINIQKAIERLFLRS
PETKVILKTENTREIEQNAEMFSDFHGYIQNLIIRDIFVDLNVGIIDAWDMTIAYCTNNA
HPPDYVIQNQIGMFLNYIC
Download sequence
Identical sequences Q96DL1
ENSP00000374237 NP_872301.2.87134 NP_872301.2.92137 ENSP00000374237 gi|210147446|ref|NP_872301.2| 9606.ENSP00000374237 ENSP00000364624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]