SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000377141 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377141
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 1.08e-82
Family Arrestin/Vps26-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 177-393
Classification Level Classification E-value
Superfamily E set domains 1.17e-73
Family Arrestin/Vps26-like 0.00000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377141   Gene: ENSG00000137486   Transcript: ENST00000393505
Sequence length 418
Comment pep:known chromosome:GRCh37:11:74976482:75062873:-1 gene:ENSG00000137486 transcript:ENST00000393505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLRGLCFSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Download sequence
Identical sequences ENSP00000377141 ENSP00000436530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]