SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000378532 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000378532
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.0217
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378532   Gene: ENSG00000122958   Transcript: ENST00000395098
Sequence length 251
Comment pep:known chromosome:GRCh37:10:70883908:70932612:1 gene:ENSG00000122958 transcript:ENST00000395098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGDNFMEKSS
Download sequence
Identical sequences A0A2I3GPR1 A0A2I3MNL5 A0A2I3RB92 A0A2J8RN58 A0A2K5K9W8 A0A2K5MVK8 A0A2K5VCT2 A0A2K6D6Y4 A0A2K6K256 A0A2K6NBZ9 F6SZY8
ENSP00000378532 NP_001030337.1.87134 NP_001030337.1.92137 XP_011782495.1.43180 XP_016773951.1.37143 gi|78482614|ref|NP_001030337.1| ENSP00000378532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]