SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000378599 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378599
Domain Number 1 Region: 104-240
Classification Level Classification E-value
Superfamily CBS-domain pair 2.22e-33
Family CBS-domain pair 0.0000002
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily CBS-domain pair 5.63e-22
Family CBS-domain pair 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378599   Gene: ENSG00000181929   Transcript: ENST00000395170
Sequence length 247
Comment pep:known chromosome:GRCh37:12:49396058:49412592:-1 gene:ENSG00000181929 transcript:ENST00000395170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSS
LIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANI
AMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTK
ALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVL
TGGEKKP
Download sequence
Identical sequences XP_005269077.1.92137 XP_016875111.1.92137 XP_016875112.1.92137 ENSP00000378599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]