SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378690 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378690
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily EF-hand 1.29e-25
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378690   Gene: ENSG00000183166   Transcript: ENST00000395275
Sequence length 261
Comment pep:known chromosome:GRCh37:7:71244476:71877358:-1 gene:ENSG00000183166 transcript:ENST00000395275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Download sequence
Identical sequences A0A2I2ZYF8 H2QUP0
9598.ENSPTRP00000032917 9606.ENSP00000378690 ENSPTRP00000032917 ENSP00000378690 ENSP00000378690 ENSP00000391882 NP_113656.2.87134 NP_113656.2.92137 XP_008961619.1.60992 XP_009451613.1.37143 XP_016813122.1.37143 XP_016868164.1.92137 XP_016868165.1.92137 ENSP00000378690 ENSPTRP00000032917 gi|157743275|ref|NP_113656.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]