SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000380276 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380276
Domain Number 1 Region: 313-509,610-866
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-116
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 56-194
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-43
Family DEP domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 517-619
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-36
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 187-316
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-25
Family cAMP-binding domain 0.000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380276   Gene: ENSG00000091428   Transcript: ENST00000397087
Sequence length 867
Comment pep:putative chromosome:GRCh37:2:173686303:173917621:1 gene:ENSG00000091428 transcript:ENST00000397087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYKKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKIL
RAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQV
LLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGP
DAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVL
FNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCH
FLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGT
PEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQPSQGTEQ
EKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAALKEQLP
ELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTI
RVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACP
REQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHTFGRH
NFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFF
AIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFM
PLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVR
SYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences A0A2J8PR02
ENSP00000380276 gi|155030206|ref|NP_001093867.1| NP_001093867.1.87134 NP_001093867.1.92137 XP_003824299.1.60992 ENSP00000380276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]