SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000380892 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380892
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.08e-49
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000581
Further Details:      
 
Domain Number 2 Region: 122-243
Classification Level Classification E-value
Superfamily E set domains 5.6e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380892   Gene: ENSG00000131196   Transcript: ENST00000397790
Sequence length 353
Comment pep:known chromosome:GRCh37:18:77155944:77289323:1 gene:ENSG00000131196 transcript:ENST00000397790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVID
CAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSA
QELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCK
PNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPA
PTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLS
PAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQ
Download sequence
Identical sequences NP_765976.1.87134 NP_765976.1.92137 ENSP00000380892 gi|27502388|ref|NP_765976.1| ENSP00000380892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]