SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000381907 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381907
Domain Number 1 Region: 155-344
Classification Level Classification E-value
Superfamily E set domains 1.63e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000191
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381907   Gene: ENSG00000157551   Transcript: ENST00000398934
Sequence length 375
Comment pep:known chromosome:GRCh37:21:39644429:39673748:1 gene:ENSG00000157551 transcript:ENST00000398934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences H2QL11 Q99712
9598.ENSPTRP00000023935 9606.ENSP00000331698 NP_001263364.1.87134 NP_001263364.1.92137 NP_001263365.1.87134 NP_001263365.1.92137 NP_001263366.1.87134 NP_001263366.1.92137 NP_001263367.1.87134 NP_001263367.1.92137 NP_001263368.1.87134 NP_001263368.1.92137 NP_002234.2.87134 NP_002234.2.92137 NP_733932.1.87134 NP_733932.1.92137 NP_733933.1.87134 NP_733933.1.92137 XP_001170473.1.37143 XP_003319114.1.37143 XP_003319118.1.37143 XP_003823976.1.60992 XP_003823982.1.60992 XP_003823985.1.60992 XP_005261032.1.92137 XP_006724065.1.92137 XP_008975886.1.60992 XP_009423993.1.37143 XP_009424305.1.37143 XP_011527862.1.92137 XP_011527863.1.92137 XP_016883832.1.92137 XP_016883833.1.92137 XP_016883834.1.92137 ENSP00000331698 ENSPTRP00000023935 gi|21361127|ref|NP_002234.2| gi|25777638|ref|NP_733932.1| gi|25777640|ref|NP_733933.1| ENSP00000331698 ENSP00000381904 ENSP00000381905 ENSP00000381907 ENSP00000381911 ENSP00000479100 ENSP00000484960 ENSPTRP00000023935 ENSP00000331698 ENSP00000381904 ENSP00000381905 ENSP00000381907 ENSP00000381911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]