SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000383556 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383556
Domain Number 1 Region: 7-160
Classification Level Classification E-value
Superfamily E set domains 7e-54
Family RhoGDI-like 0.000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383556   Gene: ENSG00000141522   Transcript: ENST00000400721
Sequence length 160
Comment pep:novel chromosome:GRCh37:17:79825773:79829252:-1 gene:ENSG00000141522 transcript:ENST00000400721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKNDDKTDHLSWEWNLTIKKDWKD
Download sequence
Identical sequences A0A2I3N7R2 A0A2J8JG35 A0A2J8XYZ0 A0A2K5HE04 F6VTL8
gi|297374785|ref|NP_001172007.1| NP_001172007.1.87134 NP_001172007.1.92137 XP_011817778.1.43180 XP_011851238.1.47321 ENSP00000383556 ENSP00000383556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]