SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000383569 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383569
Domain Number 1 Region: 109-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-33
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 2 Region: 44-101
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000498
Family cAMP-binding domain 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383569   Gene: ENSG00000188191   Transcript: ENST00000400758
Sequence length 242
Comment pep:novel chromosome:GRCh37:7:589907:642320:-1 gene:ENSG00000188191 transcript:ENST00000400758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPPHRGNAHHPRPGLVLIFSAGGHPPAPAPGPSRQHAEDFLGEVYVNGEWVTNISEGGS
FGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESL
EKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLG
PSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISL
TV
Download sequence
Identical sequences H7BYW5
ENSP00000383569 ENSP00000383569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]