SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384200 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384200
Domain Number 1 Region: 354-660
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.88e-89
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 211-328
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-33
Family cAMP-binding domain 0.00058
Further Details:      
 
Domain Number 3 Region: 79-203
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-30
Family cAMP-binding domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384200   Gene: ENSG00000185532   Transcript: ENST00000401604
Sequence length 671
Comment pep:known chromosome:GRCh37:10:52750945:54055274:1 gene:ENSG00000185532 transcript:ENST00000401604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
Download sequence
Identical sequences A0A2I2YA88 A0A2I3LDF5 A0A2J8WQQ0 A0A2K5IJD1 A0A2K5VZ60 A0A2K6BZK8 F7G3M3 K6ZDM7 Q13976
gi|148612818|ref|NP_001091982.1| HR3527 ENSP00000384200 NP_001091982.1.87134 NP_001091982.1.92137 XP_001099261.1.72884 XP_001162783.1.37143 XP_005565905.1.63531 XP_007961640.1.81039 XP_011738668.1.29376 XP_011794152.1.43180 XP_018890510.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]