SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384264 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384264
Domain Number 1 Region: 475-666
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.35e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 228-473
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSP00000384264
Domain Number - Region: 687-733
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384264   Gene: ENSG00000198515   Transcript: ENST00000402813
Sequence length 759
Comment pep:known chromosome:GRCh37:4:47937994:47983552:-1 gene:ENSG00000198515 transcript:ENST00000402813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRSSPRLECSGAISAHCSLHLPDSSDFQLIFVFLVEMGFHHVGQAGLELLISSDLPTS
ASQSAGITDMKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSAST
SEESENENPHARGSFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKE
KKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFC
ITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVK
EELKLINKYKSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETR
TNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVY
SLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQ
ARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHL
DTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDG
VTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDA
KTMLEEKGKQILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESM
QQKLKQRLTKVEKFLKPLIDTEFSSIEGPGAESGPIDST
Download sequence
Identical sequences ENSP00000384264 ENSP00000443401 NP_001136036.1.87134 NP_001136036.1.92137 gi|217035093|ref|NP_001136036.1| ENSP00000384264 ENSP00000421110 9606.ENSP00000384264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]