SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386251 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386251
Domain Number 1 Region: 145-336
Classification Level Classification E-value
Superfamily E set domains 4.57e-54
Family Cytoplasmic domain of inward rectifier potassium channel 0.00024
Further Details:      
 
Domain Number 2 Region: 36-188
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-25
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386251   Gene: ENSG00000115474   Transcript: ENST00000410029
Sequence length 360
Comment pep:known chromosome:GRCh37:2:233632850:233636115:-1 gene:ENSG00000115474 transcript:ENST00000410029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Download sequence
Identical sequences O60928
ENSP00000233826 ENSP00000386251 gi|156119627|ref|NP_002233.2| 9606.ENSP00000233826 ENSP00000233826 ENSP00000386251 ENSP00000233826 NP_002233.2.87134 NP_002233.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]