SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386444 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386444
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily E set domains 1.77e-69
Family Arrestin/Vps26-like 0.000000067
Further Details:      
 
Domain Number 2 Region: 188-392
Classification Level Classification E-value
Superfamily E set domains 4.34e-63
Family Arrestin/Vps26-like 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386444   Gene: ENSG00000130561   Transcript: ENST00000409110
Sequence length 405
Comment pep:known chromosome:GRCh37:2:234216467:234255701:1 gene:ENSG00000130561 transcript:ENST00000409110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Download sequence
Identical sequences P10523
ENSP00000386444 ENSP00000386444 ENSP00000392889 NP_000532.2.87134 NP_000532.2.92137 gi|116008178|ref|NP_000532.2| 9606.ENSP00000386444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]