SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386753 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386753
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000181
Family Ubiquitin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386753   Gene: ENSG00000116030   Transcript: ENST00000409181
Sequence length 58
Comment pep:putative chromosome:GRCh37:2:203071593:203103292:-1 gene:ENSG00000116030 transcript:ENST00000409181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQVSL
Download sequence
Identical sequences A0A2J8N5D5 A0A2J8WUW2 B8ZZJ0
ENSP00000386753 ENSP00000386753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]