SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387104 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387104
Domain Number 1 Region: 457-653,754-942
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-79
Family Ras GEF 0.0026
Further Details:      
 
Domain Number 2 Region: 200-338
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-43
Family DEP domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 661-763
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-36
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 21-157
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-26
Family cAMP-binding domain 0.000000194
Further Details:      
 
Domain Number 5 Region: 331-460
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-25
Family cAMP-binding domain 0.000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387104   Gene: ENSG00000091428   Transcript: ENST00000409036
Sequence length 943
Comment pep:novel chromosome:GRCh37:2:173600695:173917621:1 gene:ENSG00000091428 transcript:ENST00000409036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA
FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWERMIANTARTVRYYRSQP
FNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences A0A2J8PQZ0 E9PB94
ENSP00000387104 ENSP00000387104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]