SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387108 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387108
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily E set domains 5.04e-28
Family RhoGDI-like 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387108   Gene: ENSG00000156973   Transcript: ENST00000409772
Sequence length 93
Comment pep:putative chromosome:GRCh37:2:232597514:232646001:-1 gene:ENSG00000156973 transcript:ENST00000409772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEVGTLS
Download sequence
Identical sequences A0A2I2YIR1 A0A2I3S9H0 A0A2J8TQ69 A0A2K5C140 A0A2K5R390 A0A2K6TJM9 B8ZZK5
NP_001277947.1.87134 NP_001277947.1.92137 XP_009442825.1.37143 XP_010339463.1.74449 XP_012289562.1.9421 XP_017372025.1.71028 ENSP00000387108 ENSP00000387108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]