SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387386 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387386
Domain Number 1 Region: 17-175
Classification Level Classification E-value
Superfamily CBS-domain pair 5.94e-42
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 179-316
Classification Level Classification E-value
Superfamily CBS-domain pair 1.18e-31
Family CBS-domain pair 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387386   Gene: ENSG00000106617   Transcript: ENST00000418337
Sequence length 328
Comment pep:putative chromosome:GRCh37:7:151253210:151329439:-1 gene:ENSG00000106617 transcript:ENST00000418337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFM
KQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSI
VGIISLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences A0A2J8JZE9 A0A2J8RKG8 G1QX87
GO.33862 ENSP00000387386 gi|100913189|ref|NP_077747.1| NP_001291460.1.87134 NP_001291460.1.92137 NP_077747.1.87134 NP_077747.1.92137 XP_012367764.1.23891 XP_016801409.1.37143 ENSP00000387386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]