SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387870 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387870
Domain Number 1 Region: 368-542
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.07e-61
Family Sec63 N-terminal domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 41-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.31e-44
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Domain Number 3 Region: 250-351
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000843
Family RecQ helicase DNA-binding domain-like 0.074
Further Details:      
 
Weak hits

Sequence:  ENSP00000387870
Domain Number - Region: 543-586
Classification Level Classification E-value
Superfamily E set domains 0.0266
Family Sec63 C-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387870   Gene: ENSG00000144028   Transcript: ENST00000429650
Sequence length 595
Comment pep:known chromosome:GRCh37:2:96940755:96951114:-1 gene:ENSG00000144028 transcript:ENST00000429650 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNIS
HTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCT
EKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWG
MNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDF
FKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNL
QGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFS
MSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNL
LLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAM
WSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNR
YPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQFRAGRSGSRL
Download sequence
Identical sequences A0A2J8PXZ0 A0A2J8R586 B4E0P5
ENSP00000387870 ENSP00000387870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]