SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389038 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389038
Domain Number 1 Region: 441-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-79
Family Protein kinases, catalytic subunit 0.000000367
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.09e-32
Family cAMP-binding domain 0.00094
Further Details:      
 
Domain Number 3 Region: 151-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-28
Family cAMP-binding domain 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSP00000389038
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00785
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389038   Gene: ENSG00000138669   Transcript: ENST00000418486
Sequence length 733
Comment pep:known chromosome:GRCh37:4:82010583:82136218:-1 gene:ENSG00000138669 transcript:ENST00000418486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELC
SPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHR
LGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDF
SVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQ
NPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKG
MPPDELSGWDKDF
Download sequence
Identical sequences A0A2J8PG23
NP_001269414.1.87134 NP_001269414.1.92137 XP_003832317.1.60992 XP_018880624.1.27298 ENSP00000389038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]