SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000389344 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389344
Domain Number 1 Region: 31-132
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000259
Family CBS-domain pair 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389344   Gene: ENSG00000184908   Transcript: ENST00000431772
Sequence length 146
Comment pep:known chromosome:GRCh37:1:16378818:16383803:1 gene:ENSG00000184908 transcript:ENST00000431772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQSCQPSFYDGTVIVKKLPYLPRILGRNIGSHRVRVEHFMNHSITTLAKDMPLEEVVKVV
TSTDVAKYPLVESTESQILVGIVRRAQLVQALKAEPPSWAPGHQCLQDILAAGCPTEPVT
LKLSPETSLHEAQMPSGVVWFPVRGS
Download sequence
Identical sequences Q5T5Q6
ENSP00000389344 ENSP00000389344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]