SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000392889 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392889
Domain Number 1 Region: 54-233
Classification Level Classification E-value
Superfamily E set domains 9.33e-60
Family Arrestin/Vps26-like 0.0000000402
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily E set domains 0.000000000000287
Family Arrestin/Vps26-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392889   Gene: ENSG00000130561   Transcript: ENST00000449594
Sequence length 235
Comment pep:known chromosome:GRCh37:2:234228194:234252399:1 gene:ENSG00000130561 transcript:ENST00000449594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRA
EAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLY
SSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASST
IIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPGK
Download sequence
Identical sequences B7Z7L5
ENSP00000392889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]