SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393105 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393105
Domain Number 1 Region: 41-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.47e-28
Family Nitrogenase iron protein-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393105   Gene: ENSG00000136682   Transcript: ENST00000456188
Sequence length 182
Comment pep:known chromosome:GRCh37:2:114195399:114253376:1 gene:ENSG00000136682 transcript:ENST00000456188 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLPAVGSADEEEDPAEEDCPELVPMETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLN
YILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAI
ENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKAKNW
TT
Download sequence
Identical sequences F8WEU0
ENSP00000393105 ENSP00000393105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]