SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393869 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393869
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000192
Family Armadillo repeat 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393869   Gene: ENSG00000102753   Transcript: ENST00000436760
Sequence length 91
Comment pep:putative chromosome:GRCh37:13:50275346:50279888:-1 gene:ENSG00000102753 transcript:ENST00000436760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDI
YKLAFEIIDQYFSGDDIDEDPCLIPEATQGG
Download sequence
Identical sequences H0Y4S9
ENSP00000393869 ENSP00000393869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]