SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395265 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395265
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSP00000395265
Domain Number - Region: 79-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000602
Family BphP N-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395265   Gene: ENSG00000170485   Transcript: ENST00000451740
Sequence length 107
Comment pep:novel chromosome:GRCh37:2:101541624:101554304:1 gene:ENSG00000170485 transcript:ENST00000451740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNGKEVSAQTEICDIQQD
WKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLP
Download sequence
Identical sequences A0A2J8JDB3 A0A2J8RN20 H7C0J4
ENSP00000395265 ENSP00000395265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]