SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395672 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000395672
Domain Number - Region: 59-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00012
Family Heme-binding PAS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395672   Gene: ENSG00000115687   Transcript: ENST00000433589
Sequence length 193
Comment pep:novel chromosome:GRCh37:2:242076422:242079010:-1 gene:ENSG00000115687 transcript:ENST00000433589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMFCSPAGQHIRCSRVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQ
SDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSVGRARD
GTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLITLLPDGTIHGINHSFA
LTLFGYGKTELLG
Download sequence
Identical sequences H7C0L7
ENSP00000395672 ENSP00000395672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]