SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000395708 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395708
Domain Number 1 Region: 348-531,644-863,893-923
Classification Level Classification E-value
Superfamily Ras GEF 4.84e-104
Family Ras GEF 0.00049
Further Details:      
 
Domain Number 2 Region: 97-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-28
Family DEP domain 0.0000456
Further Details:      
 
Domain Number 3 Region: 552-653
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-26
Family Ras-binding domain, RBD 0.0082
Further Details:      
 
Domain Number 4 Region: 221-350
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.12e-26
Family cAMP-binding domain 0.0000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395708   Gene: ENSG00000079337   Transcript: ENST00000449771
Sequence length 923
Comment pep:known chromosome:GRCh37:12:48130841:48152428:-1 gene:ENSG00000079337 transcript:ENST00000449771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences O95398
9606.ENSP00000395708 ENSP00000373864 ENSP00000395708 ENSP00000373864 ENSP00000395708 ENSP00000171000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]