SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000396421 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396421
Domain Number 1 Region: 102-187
Classification Level Classification E-value
Superfamily E set domains 0.000000016
Family Filamin repeat (rod domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000396421
Domain Number - Region: 448-550
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0513
Family Putative acetylxylan esterase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396421   Gene: ENSG00000144815   Transcript: ENST00000422132
Sequence length 559
Comment pep:known chromosome:GRCh37:3:101504244:101547073:1 gene:ENSG00000144815 transcript:ENST00000422132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTNFFKLRLFCCLLAVLMVVVLVINVTQVEYLDHETVSATFIDSSGQFVSSQVTGISRN
PYCGYDQQTLSSQERMEEDSLLAALHRQVPDVGPVPFVKSTDPSSSYFVILNSAAFFKVG
SQLEVLVHVQDFQRKPKKYGGDYLQARIHSLKLQAGAVGRVVDYQNGFYKVFFTLLWPGK
VKVSVSLVHPSEGIRVLQRLQEDKPDRVYFKSLFRSGRISETTECNVCLPGNLPLCNFTD
LYTGEPWFCFKPKKLPCSSRITHFKGGYLKGLLTAAESAFFQSGVNIKMPVNSSGPDWVT
VIPRRIKETNSLELSQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITECLQRKVVHLFG
DSTIRQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN
ELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVV
IRTANAQELGPEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDAWEMTLAHYLPHKLHPDE
VIVKNQLDMFLSFVCPLET
Download sequence
Identical sequences Q969Y0
ENSP00000273347 ENSP00000396421 ENSP00000417485 ENSP00000418369 ENSP00000396421 ENSP00000273347 ENSP00000396421 ENSP00000417485 ENSP00000418369 NYSGRC-21450781 NP_001127928.1.87134 NP_001127928.1.92137 NP_659474.1.87134 NP_659474.1.92137 gi|197333800|ref|NP_001127928.1| gi|21450781|ref|NP_659474.1| 9606.ENSP00000273347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]