SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000396649 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396649
Domain Number 1 Region: 31-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 118-175
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396649   Gene: ENSG00000134852   Transcript: ENST00000435527
Sequence length 182
Comment pep:known chromosome:GRCh37:4:56329865:56412713:-1 gene:ENSG00000134852 transcript:ENST00000435527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TP
Download sequence
Identical sequences A0A2J8PEN8 A0A2J8SGM3 C9JK03
ENSP00000396649 ENSP00000396649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]