SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397595 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397595
Domain Number 1 Region: 71-143
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 158-204
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000209
Family Heme-binding PAS domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397595   Gene: ENSG00000170485   Transcript: ENST00000427413
Sequence length 207
Comment pep:putative chromosome:GRCh37:2:101437487:101564761:1 gene:ENSG00000170485 transcript:ENST00000427413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAYGFVGRCAPFPAEEGRTFDLSEELGRSVTREGTGTTRLNSEPVPLLCLPLLNCSRKN
CIENLMDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGF
LQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITP
LLGHLPSDVMDQNLLNFLPEQEHSEVY
Download sequence
Identical sequences H7C0Z2
ENSP00000397595 ENSP00000397595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]